PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3B_174B7D5D2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family B3
Protein Properties Length: 118aa    MW: 12524.4 Da    PI: 9.6566
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3B_174B7D5D2.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B337.64.1e-121335587
                          ETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                    B3 55 ksgryvltkGWkeFvkangLkegDfvvFkldgr 87
                          +s++yvltkGW++Fvk++gL +gD+v F+++  
  Traes_3B_174B7D5D2.1  1 SSQSYVLTKGWSRFVKEKGLGAGDVVGFYRSAA 33
                          5899*************************7644 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508639.545150IPR003340B3 DNA binding domain
PfamPF023622.9E-9133IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.0E-13159IPR015300DNA-binding pseudobarrel domain
CDDcd100171.65E-9136No hitNo description
SuperFamilySSF1019361.49E-9234IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
SSQSYVLTKG WSRFVKEKGL GAGDVVGFYR SAAGSTGEDT KLFIDCKLRP DTNSPASADP  60
VDQSAPVQKA VRLFGVDLLT APASPEQGMP GCKRARDLVK SPPPKVAFKK QCIELALA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3696811e-112AK369681.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2095J19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569603.17e-48PREDICTED: AP2/ERF and B3 domain-containing protein Os01g0693400-like
SwissprotQ8RZX93e-43Y1934_ORYSJ; AP2/ERF and B3 domain-containing protein Os01g0693400
TrEMBLM0W5J26e-66M0W5J2_HORVD; Uncharacterized protein
STRINGMLOC_44012.12e-65(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45638203
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68840.24e-20related to ABI3/VP1 2